Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Human Neuropeptide Y/NPY Antibody, R&D Systems™
GREENER_CHOICE

Catalog No. MAB8517
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
MAB8517 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Catalog No. MAB8517 Supplier R&D Systems Supplier No. MAB8517
Add to Cart
Add to Cart
This item is not returnable. View return policy

Mouse Monoclonal Antibody

Neuropeptide Y Monoclonal specifically detects Neuropeptide Y in Human samples. It is validated for Immunohistochemistry.

Specifications

Antigen Neuropeptide Y
Applications Immunohistochemistry
Classification Monoclonal
Clone 904032
Conjugate Unconjugated
Dilution Immunohistochemistry 8-25 ug/mL
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Gene Accession No. P01303
Gene Alias 170 kDa melanoma membrane-bound gelatinase, DKFZp686G13158, DPPIV, EC 3.4.21.-, FAPA, Fibroblast activation protein alpha, fibroblast activation protein, alpha, Integral membrane serine protease, NPY, PYY4, seprase
Gene Symbols NPY
Host Species Mouse
Immunogen Neuropeptide Y/NPY conjugated to KLH YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY Accession # P01303
Purification Method Protein A or G purified from hybridoma culture supernatant
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 4852
Test Specificity Detects human Neuropeptide Y/NPY in direct ELISAs.
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Target Species Human
Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Form Supernatant
Isotype IgG2a
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.