Abnova™ Human NNAT Full-length ORF (AAH01768, 1 a.a. - 81 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Used for AP, Array, ELISA, WB-Re

The protein encoded by this gene is a proteolipid that may be involved in the regulation of ion channels during brain development. The encoded protein may also play a role in forming and maintaining the structure of the nervous system. This gene is found within an intron of the BLCAP gene, but on the opposite strand. This gene is imprinted and is expressed only from the paternal allele, while BLCAP is not imprinted. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq]

Sequence: MAAVAAASAELLIIGWYIFRVLLQVFLECCIYWVGFAFRNPPGTQPIARSEVFRYSLQKLAYTVSRTGRQVLGERRQRAPN

Specifications

• Accession Number: AAH01768
• For Use With (Application): Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 4826
• Molecular Weight (g/mol): 34.65kDa
• Name: Human NNAT Full-length ORF (AAH01768, 1 a.a. - 81 a.a.) Recombinant Protein with GST-tag at N-terminal
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25μg
• Storage Requirements: Store at −80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: MGC1439, Peg5
• Common Name: NNAT
• Gene Symbol: NNAT
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST Tag
• Expression System: wheat germ expression system
• Form: Liquid