Invitrogen™ Human Nurr1 (aa 4-124) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The Nuclear receptor related 1 protein (Nurr1) also known as NR4A2 (nuclear receptor subfamily 4, group A, member 2) is a protein that in humans is encoded by the NR4A2 gene. NURR1 is a member of the nuclear receptor family of intracellular transcription factors.Nurr1 plays a key role in the maintenance of the dopaminergic system of the brain. Mutations in this gene have been associated with disorders related to dopaminergic dysfunction, including Parkinson's disease, schizophrenia, and manic depression. Misregulation of this gene may be associated with rheumatoid arthritis. Four transcript variants encoding four distinct isoforms have been identified for this gene. Additional alternate splice variants may exist, but their full-length nature has not been determined.

Specifications

• Accession Number: P43354
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 4929
• Name: Human Nurr1 (aa 4-124) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: HZF3; Hzf-3; Immediate-early response protein NOT; intermediate-early receptor protein; NGFI-B; NGFI-B beta; NGFI-B/nur77 beta-type transcription factor homolog; NOT; NR4A2; Nuclear orphan receptor HZF-3; nuclear receptor related 1; nuclear receptor subfamily 4 group A member 2; nuclear receptor subfamily 4 group A member 2 variant TINUR; nuclear receptor subfamily 4 group A member 2 variant NURR1a; nuclear receptor subfamily 4 group A member 2 variant NURR1b; nuclear receptor subfamily 4 group A member 2 variant NURR1c; nuclear receptor subfamily 4 group A member 2 variant NURR2c; nuclear receptor subfamily 4, group A, member 2; nur related protein 1; nur related protein-1, human homolog of; Nurr1; NUR-related factor 1; orphan nuclear receptor NR4A2; orphan nuclear receptor NURR1; Regenerating liver nuclear receptor 1; RNR1; RNR-1; SL-322; T-cell nuclear receptor NOT; TINOR; TINUR; transcriptionally inducible nuclear receptor related 1; transcriptionally-inducible nuclear receptor
• Common Name: Nurr1
• Gene Symbol: NR4A2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: VQAQYGSSPQGASPASQSYSYHSSGEYSSDFLTPEFVKFSMDLTNTEITATTSLPSFSTFMDNYSTGYDVKPPCLYQMPLSGQQSSIKVEDIQMHNYQQHSHLPPQSEEMMPHSGSVYYKP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining