Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human NUS1 (aa 227-293) Control Fragment Recombinant Protein

Catalog No. RP94908
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55638 (PA5-55638. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q96E22
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 116150
Name Human NUS1 (aa 227-293) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1600027K07Rik; AU019165; AW538011; BC003223; C6orf68; Cis-prenyltransferase subunit NgBR; D10Ertd438e; dehydrodolichyl diphosphate syntase complex subunit NUS1; dehydrodolichyl diphosphate syntase complex subunit NUS1 pseudogene; dehydrodolichyl diphosphate synthase complex subunit NUS1; di-trans,poly-cis-decaprenylcistransferase; MGC:7199; NgBR; Nogo-B receptor; Nuclear undecaprenyl pyrophosphate synthase 1 homolog; nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae); Nus1; NUS1 dehydrodolichyl diphosphate synthase subunit; NUS1, dehydrodolichyl diphosphate synthase subunit; RGD1307879; TANGO14; transport and golgi organization 14 homolog
Common Name NUS1
Gene Symbol NUS1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence ASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.