Invitrogen™ Human NUS1 (aa 227-293) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (94%), Rat (94%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55638 (PA5-55638. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precursor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator.

Specifications

• Accession Number: Q96E22
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 116150
• Name: Human NUS1 (aa 227-293) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1600027K07Rik; AU019165; AW538011; BC003223; C6orf68; Cis-prenyltransferase subunit NgBR; D10Ertd438e; dehydrodolichyl diphosphate syntase complex subunit NUS1; dehydrodolichyl diphosphate syntase complex subunit NUS1 pseudogene; dehydrodolichyl diphosphate synthase complex subunit NUS1; di-trans,poly-cis-decaprenylcistransferase; MGC:7199; NgBR; Nogo-B receptor; Nuclear undecaprenyl pyrophosphate synthase 1 homolog; nuclear undecaprenyl pyrophosphate synthase 1 homolog (S. cerevisiae); Nus1; NUS1 dehydrodolichyl diphosphate synthase subunit; NUS1, dehydrodolichyl diphosphate synthase subunit; RGD1307879; TANGO14; transport and golgi organization 14 homolog
• Common Name: NUS1
• Gene Symbol: NUS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: ASLLSSNGCPDPDLVLKFGPVDSTLGFLPWHIRLTEIVSLPSHLNISYEDFFSALRQYAACEQRLGK
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining