Human Osteocalcin PE-conjugated Antibody, R&D Systems™

Mouse Monoclonal Antibody has been used in 6 publications

Supplier:  R&D Systems IC1419P

Catalog No. IC1419P

Description

Osteocalcin Monoclonal specifically detects Osteocalcin in Human samples. It is validated for Intracellular Staining by Flow Cytometry.

Specifications

• Antigen: Osteocalcin
• Classification: Monoclonal
• Conjugate: R-PE
• Formulation: Supplied in a saline solution containing BSA and Sodium Azide. with Sodium Azide
• Gene Alias: BGLAP, BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin
• Host Species: Mouse
• Purification Method: Protein A or G purified from hybridoma culture supernatant
• Regulatory Status: RUO
• Gene ID (Entrez): 632
• Target Species: Human
• Form: Purified

• Applications: Flow Cytometry
• Clone: 190125
• Dilution: Intracellular Staining by Flow Cytometry 10 uL/10^6 cells
• Gene Accession No.: P02818
• Gene Symbols: BGLAP
• Immunogen: Human Osteocalcin synthetic peptide YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Accession # P02818
• Quantity: 100 Tests
• Primary or Secondary: Primary
• Test Specificity: Detects human Osteocalcin in direct ELISAs.
• Content And Storage: Protect from light. Do not freeze. 12 months from date of receipt, 2 to 8 degreesC as supplied.
• Isotype: IgG1