Invitrogen™ Human PPP2R5D (aa 483-580) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (99%), Rat (99%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-83053 (PA5-83053. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. ZNF265 (Zinc finger protein 265), also known as ZRANB2 (Zinc finger Ran-binding domain-containing protein 2), ZIS, ZIS1 or ZIS2, is a 330 amino acid protein that belongs to the ZRANB2 family. Localized to the nucleus, ZNF265 functions as a splicing factor that is responsible for alternatively splicing Tra-2 beta (transformer-2 beta) transcripts and is thought to interfere with constitutive 5'-splice selection. ZNF265 contains two RanBP2-type zinc fingers through which it conveys its RNA-binding activity. Two isoforms, designated ZIS-1 and ZIS-2, are expressed due to alternative splicing events. Upon DNA damage, ZIS-2 may be phosphorylated by ATM or ATR.

Specifications

• Accession Number: Q14738
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5528
• Name: Human PPP2R5D (aa 483-580) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: B56D; B'delta; MGC2134; MGC8949; MRD35; PP2A B subunit isoform B56-delta; PP2A B subunit isoform B'-delta; PP2A B subunit isoform PR61-delta; PP2A B subunit isoform R5-delta; PP2A, B subunit, B' delta isoform; PP2A, B subunit, B56 delta isoform; PP2A, B subunit, PR61 delta isoform; PP2A, B subunit, R5 delta isoform; PP2CB; Ppp2r5d; protein phosphatase 2 regulatory subunit B'delta; protein phosphatase 2, regulatory subunit B (B56), delta isoform; protein phosphatase 2, regulatory subunit B', delta; protein phosphatase 2, regulatory subunit B', delta isoform; Serine/threonine protein phosphatase 2 A, 56 kDa regulatory subunit, delta isoform; serine/threonine-protein phosphatase 2 A 56 kDa regulatory subunit delta isoform; TEG-271; testis expressed gene 271; Te x 271
• Common Name: PPP2R5D
• Gene Symbol: PPP2R5D
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: DCTQQYKAEKQKGRFRMKEREEMWQKIEELARLNPQYPMFRAPPPLPPVYSMETETPTAEDIQLLKRTVETEAVQMLKDIKKEKVLLRRKSELPQDVY
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining