Abnova™ Human PRDX2 (NP_005800, 1 a.a. - 198 a.a.) Full-length Recombinant Protein

Description

Used for Func, SDS-PAGE

This gene encodes a member of the peroxiredoxin family of antioxidant enzymes, which reduce hydrogen peroxide and alkyl hydroperoxides. The encoded protein may play an antioxidant protective role in cells, and may contribute to the antiviral activity of CD8(+) T-cells. This protein may have a proliferative effect and play a role in cancer development or progression. The crystal structure of this protein has been resolved to 2.7 angstroms. Transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq]

Sequence: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN

Specifications

• Accession Number: NP_005800
• Concentration: 1 mg/mL
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Liquid
• Gene ID (Entrez): 7001
• Molecular Weight (g/mol): 21.8kDa
• Name: PRDX2 (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Conventional Chromatography
• Quality Control Testing: Loading 3 ug protein in 15% SDS-PAGE
• Quantity: 100 μg
• Immunogen: MASGNARIGKPAPDFKATAVVDGAFKEVKLSDYKGKYVVLFFYPLDFTFVCPTEIIAFSNRAEDFRKLGCEVLGVSVDSQFTHLAWINTPRKEGGLGPLNIPLLADVTRRLSEDYGVLKTDEGIAYRGLFIIDGKGVLRQITVNDLPVGRSVDEALRLVQAFQYTDEHGEVCPAGWKPGSDTIKPNVDDSKEYFSKHN
• Storage Requirements: Store at 4°C for 1-2 weeks. For long term storage store at -20°C or -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: MGC4104/NKEFB/PRP/PRX2/PRXII/TDPX1/TSA
• Common Name: PRDX2
• Gene Symbol: PRDX2
• Biological Activity: Specific activity: approximately 200-230pmole/min/μg. Enzymatic activity was confirmed by measuring the remaining peroxide after incubation of PRDX2 and peroxide for 20 min at room temperature. Specific activity is defined as the amount of hydroperoxide
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Liquid
• Purity or Quality Grade: >90% by SDS-PAGE