Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94588

Invitrogen™ Human PSMB1 (aa 83-157) Control Fragment Recombinant Protein

Catalog No. RP94588
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56219 (PA5-56219. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

PSMB1 is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number P20618
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 5689
Name Human PSMB1 (aa 83-157) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias AA409053; C81484; component C5 of proteasome; HC5; Lmpc5; Macropain subunit C5; multicatalytic endopeptidase complex subunit C5; PMSB1; proteasome (prosome, macropain) subunit, beta type 1; proteasome (prosome, macropain) subunit, beta type, 1; proteasome beta 1 subunit; proteasome beta-subunit C5; proteasome component C5; Proteasome gamma chain; proteasome subunit beta 1; proteasome subunit beta type-1; proteasome subunit C5; proteasome subunit HC5; proteasome subunit RC5; PSC5; Psmb1; testicular secretory protein Li 45
Common Name PSMB1
Gene Symbol PSMB1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence SGFHGDCLTLTKIIEARLKMYKHSNNKAMTTGAIAAMLSTILYSRRFFPYYVYNIIGGLDEEGKGAVYSFDPVGS
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.