Invitrogen™ Human PTPRU (aa 28-111) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (90%), Rat (90%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-58948 (PA5-58948. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation. This PTP possesses an extracellular region, a single transmembrane region, and two tandem intracellular catalytic domains, and thus represents a receptor-type PTP. The extracellular region contains a meprin-A5 antigen-PTP (MAM) domain, Ig-like and fibronectin type III-like repeats. This PTP was thought to play roles in cell-cell recognition and adhesion. Studies of the similar gene in mice suggested the role of this PTP in early neural development. The expression of this gene was reported to be regulated by phorbol myristate acetate (PMA) or calcium ionophore in Jurkat T lymphoma cells. Alternatively spliced transcript variants have been reported.

Specifications

• Accession Number: Q92729
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10076
• Name: Human PTPRU (aa 28-111) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: FMI; Ftp-1; GLEPP1; hPTP-J; Pancreatic carcinoma phosphatase 2; Pcp2; PCP-2; pi R-PTP-Psi; protein tyrosine phosphatase, receptor type U; protein tyrosine phosphatase, receptor type, L; protein tyrosine phosphatase, receptor type, U; protein-tyrosine phosphatase J; Protein-tyrosine phosphatase pi; protein-tyrosine phosphatase receptor omicron; Protein-tyrosine phosphatase-lamda; PTP; PTP pi; Ptpf; PTP-J; PTPlambda; PTP-lambda; PTP-PI; PTPPSI; Ptprl; PTPRO; PTP-RO; PTPRU; PTPU2; Receptor protein tyrosine phosphatase hPTP-J; receptor-type protein-tyrosine phosphatase psi; Receptor-type tyrosine-protein phosphatase U; RPTPlambda; R-PTP-psi; R-PTP-U
• Common Name: PTPRU
• Gene Symbol: PTPRU
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGSYLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining