Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Human/Rat Osteocalcin Alexa Fluor 700-conjugated Antibody, R&D Systems™

Mouse Monoclonal Antibody
Supplier: R&D Systems IC1419N100UG
This item is not returnable.
View return policy
Description
Osteocalcin Monoclonal specifically detects Osteocalcin in Human, Rat samples. It is validated for Intracellular Staining by Flow Cytometry.Specifications
Osteocalcin | |
Monoclonal | |
0.2 mg/mL | |
Intracellular Staining by Flow Cytometry 0.25-1 ug/10^6 cells | |
P02818 | |
BGLAP | |
Human Osteocalcin synthetic peptide YLYQWLGAPVPYPDPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV Accession # P02818 | |
RUO | |
632 | |
Human, Rat | |
IgG1 |
Flow Cytometry | |
190125 | |
Alexa Fluor 700 | |
Supplied 0.2 mg/mL in a saline solution containing BSA and Sodium Azide. with 0.09% Sodium Azide | |
BGLAP, BGP, bone gamma-carboxyglutamate (gla) protein, bone gamma-carboxyglutamate (gla) protein (osteocalcin), Bone Gla protein, Gamma-carboxyglutamic acid-containing protein, OC, OCN, osteocalcin | |
Mouse | |
100 μg | |
Primary | |
Detects human Osteocalcin in direct ELISAs. | |
Store the unopened product at 2 - 8 degreesC. Do not use past expiration date. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only (RUO)
Spot an opportunity for improvement?Share a Content Correction