Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human RCBTB1 Partial ORF (NP_060661.3, 2 a.a. - 90 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

$460.50 - $709.50

Specifications

Name RCBTB1 (Human) Recombinant Protein (Q01)
Recombinant Yes
For Use With (Application) Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Molecular Weight 35.53kDa
Storage Requirements Store at -80°C. Aliquot to avoid repeated freezing and thawing.
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
89-959-633
View Documents
Abnova™
H00055213Q01S
10 ug
Each for $460.50
Add to cart
 
89-959-634
View Documents
Abnova™
H00055213Q01L
25 ug
Each for $709.50
Add to cart
 
Description

Description

This gene encodes a protein with an N-terminal RCC1 domain and a C-terminal BTB (broad complex, tramtrack and bric-a-brac) domain. In rat, over-expression of this gene in vascular smooth muscle cells induced cellular hypertrophy. In rat, the C-terminus of RCBTB1 interacts with the angiotensin II receptor-1A. In humans, this gene maps to a region of chromosome 13q that is frequently deleted in B-cell chronic lymphocytic leukemia and other lymphoid malignancies. [provided by RefSeq]

Sequence: VDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDNDEVFVFGLNYSNCLGTGDNQSTLVPKKLEGLCGKKIKSLSYGSGPHVLLS
Specifications

Specifications

RCBTB1 (Human) Recombinant Protein (Q01)
Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Yes
35.53kDa
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit