Invitrogen™ Human RNF19A (aa 100-159) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54861 (PA5-54861. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes a member of the ring between ring fingers (RBR) protein family, and the encoded protein contains two RING-finger motifs and an in between RING fingers motif. This protein is an E3 ubiquitin ligase that is localized to Lewy bodies, and ubiquitylates synphilin-1, which is an interacting protein of alpha synuclein in neurons. The encoded protein may be involved in amyotrophic lateral sclerosis and Parkinson's disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013].

Specifications

• Accession Number: Q9NV58
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25897
• Name: Human RNF19A (aa 100-159) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AA032313; Dorfin; Double ring-finger protein; E3 ubiquitin-protein ligase RNF19A; Gametogenesis-expressed protein GEG-154; Geg-154; p38; protein p38 interacting with transcription factor Sp1; ring finger protein (C3HC4 type) 19; ring finger protein 19; ring finger protein 19 A; ring finger protein 19 A, E3 ubiquitin protein ligase; ring finger protein 19 A, RBR E3 ubiquitin protein ligase; ring-IBR-ring domain containing protein Dorfin; Rnf19; RNF19A; Ubce7ip2; UBCM4-interacting protein 117; ubiquitin conjugating enzyme 7 interacting protein 2; UIP117; XY body protein; XYbp
• Common Name: RNF19A
• Gene Symbol: RNF19A
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: EMCTDKNSIFSTNTSSDNGLTSISKQIGDFIECPLCLLRHSKDRFPDIMTCHHRSCVDCL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining