Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP93954

Invitrogen™ Human SAPAP2 (aa 273-372) Control Fragment Recombinant Protein

Catalog No. RP93954
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (85%), Rat (85%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56438 (PA5-56438. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SAP90/PSD-95-associated protein 2 (SAPAP2, also known as DLGAP2) is a member of a protein family whose members specifically interact with PSD-95/SAP90, a membrane-associated guanylate kinase localized at postsynaptic density (PSD) in neuronal cells. Like the other SAPAP proteins, SAPAP2 is thought to be an adaptor protein that also interacts with different synaptic scaffolding proteins, cytoskeletal and signaling components, such as focal adhesion kinase (FAK) and proline-rich tyrosine kinase 2 (PYK2). SAPAP2 mRNA is targeted to cell bodies in a similar manner to SAPAP1 and -4, whereas SAPAP3 mRNA is detected mainly in cell bodies.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9P1A6
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 9228
Name Human SAPAP2 (aa 273-372) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 6430596N04Rik; Dap2; DAP-2; discs large homolog associated protein 2; discs large homolog-associated protein 2; discs large-associated protein 2; discs, large (Drosophila) homolog-associated protein 2; disks large-associated protein 2; DLG associated protein 2; Dlgap2; postsynaptic density 95; PSD-95/SAP90-associated protein-2; PSD-95/SAP90-binding protein 2; SAP90/PSD-95 associated protein 2; SAP90/PSD-95-associated protein 2; SAPAP2
Common Name SAPAP2
Gene Symbol DLGAP2
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence HSKRSKSKERKPEGKPRPGMSSWWSSDDNLDSDSTYRTPSVLNRHHLGPVAHCYPDALQSPFGDLSLKTSKSNNDVKCSACEGLALTPDAKYLKRSSWST
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.