Invitrogen™ Human SCML1 Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (26%), Rat (26%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57206 (PA5-57206. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Putative Polycomb group (PcG) protein. PcG proteins act by forming multiprotein complexes, which are required to maintain the transcriptionally repressive state of homeotic genes throughout development. May be involved in spermatogenesis during sexual maturation.

Specifications

• Accession Number: Q9UN30
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6322
• Name: Human SCML1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Scm polycomb group protein like 1; SCML1; sex comb on midleg like 1; sex comb on midleg-like 1 (Drosophila); sex comb on midleg-like protein 1
• Common Name: SCML1
• Gene Symbol: Scml1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: WTNHKPYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNSPSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining