Invitrogen™ Human SIPA1L2 (aa 1377-1460) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (83%), Rat (83%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55004 (PA5-55004. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Signal-induced proliferation associated-like protein 2 (SIPA1L2) is a member of the SIPA1 family of RapGAPs. Little is known of the role of the SIPA1L2 protein, but recent studies of SIPA indicate that its deregulation can cause myeloproliferative stem cell disorders in mice and increased metastases in human cancers. Other studies suggest SIPA1L1 may play important roles in embryo development and control of cell proliferation. Based on the amount of homology between SIPA family members, it is likely that SIPA1L2 plays a role in embryo development and cell proliferation, possibly including oncogenesis.

Specifications

• Accession Number: Q9P2F8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 57568
• Name: Human SIPA1L2 (aa 1377-1460) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BC058408; Kiaa0545; KIAA1389; mKIAA1389; serine-rich synapse associated protein 2; serine-rich synapse-associated protein; Sersap2; signal induced proliferation associated 1 like 2; signal-induced proliferation-associated 1 like 2; signal-induced proliferation-associated 1-like protein 2; Sipa1l2; SIPA1-like protein 2; SPA-1-like 2; SPAL2; Spar2
• Common Name: SIPA1L2
• Gene Symbol: SIPA1L2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QQVPGSMSKPYHRQGAVNKYVIGWKKSEGSPPPEEPEVTECPGMYSEMDVMSTATQHQTVVGDAVAETQHVLSKEDFLKLMLPD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining