Invitrogen™ Human SNAP91 (aa 274-373) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (87%), Rat (87%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56216 (PA5-56216. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Clathrin coat assembly protein AP180 is a protein that in humans is encoded by the SNAP91 gene. Adaptins are components of the adapter complexes which link clathrin to receptors in coated vesicles. Clathrin-associated protein complexes are believed to interact with the cytoplasmic tails of membrane proteins, leading to their selection and concentration. Binding of AP180 to clathrin triskelia induces their assembly into 60-70 nm coats.

Specifications

• Accession Number: O60641
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 9892
• Name: Human SNAP91 (aa 274-373) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 91 kDa synaptosomal-associated protein; 91 kDa; Ap180; assembly protein 180 (AP180); assembly protein, 180 kDa; CALM; Clathrin coat assembly protein AP180; clathrin coat-associated protein AP180; F1-20; KIAA0656; mKIAA0656; phosphoprotein F1-20; SNAP91; synaptosomal-associated protein 91; synaptosomal-associated protein 91 kDa; synaptosomal-associated protein, 91 kDa; synaptosomal-associated protein, 91 kDa homolog; synaptosome associated protein 91; synaptosome associated protein 91 kDa
• Common Name: SNAP91
• Gene Symbol: Snap91
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LMETLEQHLNTLEGKKPGNNEGSGAPSPLSKSSPATTVTSPNSTPAKTIDTSPPVDLFATASAAVPVSTSKPSSDLLDLQPDFSSGGAAAAAAPAPPPPA
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining