Invitrogen™ Human SRSF6 (aa 266-327) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (89%), Rat (89%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56034 (PA5-56034. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

SFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12. The protein encoded by this gene is involved in mRNA splicing and may play a role in the determination of alternative splicing. The encoded nuclear protein belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.

Specifications

• Accession Number: Q13247
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6431
• Name: Human SRSF6 (aa 266-327) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1210001E11Rik; AI314910; AW146126; B52; epididymis secretory protein Li 91; HEL-S-91; LOW QUALITY PROTEIN: serine/arginine-rich splicing factor 6; MGC5045; pre-mRNA-splicing factor SRP55; serine and arginine rich splicing factor 6; serine/arginine-rich splicing factor 6; serine/arginine-rich splicing factor 6-like protein; Sfrs6; splicing factor SRp55; splicing factor SRp55 homolog; splicing factor SRp55-1; splicing factor, arginine/serine-rich 6; splicing factor, arginine/serine-rich, 55 kDa; SR splicing factor 6; SRP55; SRP55-1; SRSF6
• Common Name: SRSF6
• Gene Symbol: Srsf6
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KDEYEKSRSRSRSRSPKENGKGDIKSKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSR
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining