Invitrogen™ Human SSC5D (aa 870-962) Control Fragment Recombinant Protein

Catalog No.	Quantity
RP99201	100 μL

Catalog No. RP99201 Supplier Invitrogen™ Supplier No. RP99201

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (65%), Rat (65%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-59819 (PA5-59819. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Binds to extracellular matrix proteins. Binds to pathogen-associated molecular patterns (PAMPs) present on the cell walls of Gram-positive and Gram-negative bacteria and fungi, behaving as a pattern recognition receptor (PRR). Induces bacterial and fungal aggregation and subsequent inhibition of PAMP-induced cytokine release. Does not possess intrinsic bactericidal activity. May play a role in the innate defense and homeostasis of certain epithelial surfaces.

Specifications

• Accession Number: A1L4H1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 284297
• Name: Human SSC5D (aa 870-962) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: S5D-SRCRB; scavenger receptor cysteine rich domain containing (5 domains); scavenger receptor cysteine rich family member with 5 domains; scavenger receptor cysteine rich family, 5 domains; scavenger receptor cysteine-rich glycoprotein; soluble scavenger protein with 5 SRCR domains; Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D; soluble scavenger with 5 domains; SSC5D
• Common Name: SSC5D
• Gene Symbol: SSC5D
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: TCTGYTDYDDYPPWTWDPTSREDLAKGTTTAGVPGHTLPWRTTRRPGSSSPAIRRLPDTGSKDGYKLPWTWDTPSGRGLAEGTPTAGKLGPTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining