Invitrogen™ Human TAB3 (aa 639-712) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (86%), Rat (86%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57101 (PA5-57101. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

TAB3 functions in the NF-kappaB signal transduction pathway. It and the similar and functionally redundant protein TAB2, form a ternary complex with the protein kinase TAK1 and either TRAF2 or TRAF6 in response to stimulation with the pro-inflammatory cytokines TNF or IL-1. Subsequent TAK1 kinase activity triggers a signaling cascade leading to activation of the NF-kappaB transcription factor. Recent experiments have shown that TAB2 and the related protein TAB3 constitutitvely interact with the autophagy mediator Beclin-1; upon induction of autophagy, these proteins dissociate from Beclin-1 and bind TAK1. Overexpression of TAB2 and TAB3 inhibit autophagy, while their depletion triggers it, suggesting that TAB2 and TAB3 act as a control point for autophagy.

Specifications

• Accession Number: Q8N5C8
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 257397
• Name: Human TAB3 (aa 639-712) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4921526G09Rik; Kiaa4135; MAP3K7IP3; mitogen activated protein kinase kinase kinase 7 interacting protein 3; mitogen-activated protein kinase kinase kinase 7 interacting protein 3; mitogen-activated protein kinase kinase kinase 7-interacting protein 3; mKIAA4135; NAP1; NF-kappa-B-activating protein 1; NFkB activating protein 1; Tab3; TAB-3; TAK1-binding protein 3; TGF-beta activated kinase 1 (MAP3K7) binding protein 3; TGF-beta activated kinase 1 and MAP3K7 binding protein 3; TGF-beta activated kinase 1/MAP3K7 binding protein 3; TGF-beta-activated kinase 1 and MAP3K7-binding protein 3; TGF-beta-activated kinase 1-binding protein 3
• Common Name: TAB3
• Gene Symbol: Tab3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RKARRISVTSKVQADIHDTQAAAADEHRTGSTQSPRTQPRDEDYEGAPWNCDSCTFLNHPALNRCEQCEMPRYT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining