Invitrogen™ Human TAS2R38 (aa 301-332) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (63%), Rat (63%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-62953 (PA5-62953. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-beta-2 activation and lead to the gating of TRPM5. Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells. Variations in TAS2R38 are associated with the ability to taste phenylthiocarbamide (PTC tasting); also called thiourea tasting. The ability to taste the substance PTC and a number of related substances is genetically controlled. Genetic studies have demonstrated complex inheritance for this trait. For some people (and some chimpanzees also), the chemical PTC tastes very bitter. For others, it is tasteless. Actually, substantial variation in taste sensitivity exists in human. Five haplotypes arising from three coding SNPs in the TAS2R38 gene are associated with distinct phenotypes of PTC taste sensitivity.

Specifications

• Accession Number: P59533
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 5726
• Name: Human TAS2R38 (aa 301-332) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: mt2r31; PTC; PTC bitter taste receptor; RGD:1560649}; T2R138; T2R26; T2r31; T2r38; T2r38 {ECO:0000312; T2R61; Tas2r138; Tas2r26; TAS2R38; taste 2 receptor member 38; taste receptor type 2 member 26; Taste receptor type 2 member 38; taste receptor type 2 member 61; taste receptor, type 2, member 138; taste receptor, type 2, member 38
• Common Name: TAS2R38
• Gene Symbol: TAS2R38
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: NAKLRRAVMTILLWAQSSLKVRADHKADSRTL
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining