Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human TDGF1 (P13385, 139 amino acids) Partial Recombinant Protein

Catalog No. 89964336
Click to view available options
Quantity:
10 μg

Used for Func, SDS-PAGE

Sequence: LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPS

Specifications

Accession Number P13385
For Use With (Application) Functional Study, SDS-PAGE
Formulation Lyophilized
Gene ID (Entrez) 6997
Molecular Weight (g/mol) 25kDa
Name TDGF1 (Human) Recombinant Protein
Preparation Method Escherichia coli expression system
Quantity 10 μg
Immunogen LGHQEFARPSRGYLAFRDDSIWPQEEPAIRPRSSQRVPPMGIQHSKELNRTCCLNGGTCMLGSFCACPPSFYGRNCEHDVRKENCGSVPHDTWLPKKCSLCKCWHGQLRCFPQAFLPGCDGLVMDEHLVASRTPELPPS
Storage Requirements Store at -80°C on dry atmosphere. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias CR/CRGF/CRIPTO/Cripto-1
Common Name TDGF1
Gene Symbol TDGF1
Biological Activity In a functional ELISA, immobilized recombinant human Activin RIB/Fc chimera receptor (0.2μg/mL) will bind TDGF1 with linear range of 0.8 to 100ng/mL.
Species E. coli
Recombinant Recombinant
Protein Tag None
Expression System Escherichia coli expression system
Form Lyophilized
Purity or Quality Grade ≥95% by SDS-PAGE
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.