Abnova™ Human TGFB1 (P01137) Recombinant Protein expressed in HEK293 cells

Description

Used for Func, SDS-PAGE

TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. TGFB acts synergistically with TGFA (MIM 190170) in inducing transformation. It also acts as a negative autocrine growth factor. Dysregulation of TGFB activation and signaling may result in apoptosis. Many cells synthesize TGFB and almost all of them have specific receptors for this peptide. TGFB1, TGFB2 (MIM 190220), and TGFB3 (MIM 190230) all function through the same receptor signaling systems.[supplied by OMIM]

Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Specifications

• Accession Number: P01137
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 7040
• Molecular Weight (g/mol): 25kDa
• Name: TGFB1 (Human) Recombinant Protein
• Preparation Method: Mammalian cell (HEK293) expression system
• Quantity: 20 μg
• Immunogen: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1 EU/μg
• Gene Alias: CED/DPD1/TGFB/TGFbeta
• Common Name: TGFB1
• Gene Symbol: TGFB1
• Biological Activity: The activity is determined by the dose-dependent inhibition of IL-4-induced proliferation of mouse HT-2 cells. The expected ED50 for this effect is 0.1-0.15ng/mL.
• Species: Human
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Mammalian cell (HEK293) expression system
• Form: Lyophilized