Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Abnova™ Human TGFB1 Partial ORF (NP_000651, 279 a.a. - 390 a.a.) Recombinant Protein with GST-tag at N-terminal

Catalog No. 89964530 Shop All Abnova Corporation Products
Click to view available options
Quantity:
10μg
25μg

Used for AP, Array, ELISA, WB-Re

TGFB is a multifunctional peptide that controls proliferation, differentiation, and other functions in many cell types. TGFB acts synergistically with TGFA (MIM 190170) in inducing transformation. It also acts as a negative autocrine growth factor. Dysregulation of TGFB activation and signaling may result in apoptosis. Many cells synthesize TGFB and almost all of them have specific receptors for this peptide. TGFB1, TGFB2 (MIM 190220), and TGFB3 (MIM 190230) all function through the same receptor signaling systems.[supplied by OMIM]

Sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS

Specifications

Accession Number NP_000651
For Use With (Application) Protein Array, ELISA, Western Blot
Formulation 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene ID (Entrez) 7040
Molecular Weight (g/mol) 38.06kDa
Name Human TGFB1 Partial ORF (NP_000651, 279 a.a. - 390 a.a.) Recombinant Protein with GST-tag at N-terminal
Quality Control Testing 12.5% SDS-PAGE Stained with Coomassie Blue.
Quantity 25μg
Storage Requirements Store at −80°C. Aliquot to avoid repeated freezing and thawing.
Regulatory Status RUO
Gene Alias CED, DPD1, TGFB, TGFbeta
Common Name TGFB1
Gene Symbol TGFB1
Species Wheat Germ (in vitro)
Recombinant Recombinant
Protein Tag GST Tag
Expression System wheat germ expression system
Form Liquid
Show More Show Less
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.