Invitrogen™ Human Thromboxane synthase (aa 276-331) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (50%), Rat (50%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56694 (PA5-56694. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Thromboxane synthase encodes a member of the cytochrome P450 superfamily of enzymes. The cytochrome P450 proteins are monooxygenases which catalyze many reactions involved in drug metabolism and synthesis of cholesterol, steroids and other lipids. However, this protein is considered a member of the cytochrome P450 superfamily on the basis of sequence similarity rather than functional similarity. This endoplasmic reticulum membrane protein catalyzes the conversion of prostglandin H2 to thromboxane A2, a potent vasoconstrictor and inducer of platelet aggregation. The enzyme plays a role in several pathophysiological processes including hemostasis, cardiovascular disease, and stroke. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Specifications

• Accession Number: P24557
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 6916
• Name: Human Thromboxane synthase (aa 276-331) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: BDPLT14; CYP5; Cyp5a1; cytochrome P450 5A1; cytochrome P450, family 5, subfamily A, polypeptide 1; FLJ52771; GHOSAL; platelet, cytochrome P450, subfamily V; similar to Thromboxane-A synthase (TXA synthase) (TXS); Tbxas1; THAS; ThromboxA ane synthase 1; thromboxane A synthase 1; thromboxane A synthase 1 (platelet); thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A); thromboxane A synthase 1, platelet; thromboxane synthase; thromboxane-A synthase; TS; TXA synthase; TXAS; TXS
• Common Name: Thromboxane synthase
• Gene Symbol: TBXAS1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: RDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQHQPSPMARPLTVDEI
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining