Abnova™ Human TMEFF2 Partial ORF (NP_057276.2, 201 a.a. - 292 a.a.) Recombinant Protein with GST-tag at N-terminal

Used for AP, Array, ELISA, WB-Re

Manufacturer:  Abnova™ H00023671Q01S

Catalog No. 89-964-950

Description

Sequence: SYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCD

Specifications

• Expression System: wheat germ expression system
• For Use With (Application): Antibody Production, Enzyme-linked Immunoabsorbent Assay, Protein Array, Western Blot (Recombinant protein)
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Weight: 35.86kDa
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Immunogen: SYDNACQIKEASCQKQEKIEVMSLGRCQDNTTTTTKSEDGHYARTDYAENANKLEESAREHHIPCPEHYNGFCMHGKCEHSINMQEPSCRCD
• Regulatory Status: RUO
• Common Name: TMEFF2
• Host Species: Wheat Germ (in vitro)
• Protein Tag: GST

• Accession Number: NP_057276.2
• Format: Liquid
• Gene ID (Entrez): 23671
• Name: TMEFF2 (Human) Recombinant Protein (Q01)
• Quantity: 10 ug
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Gene Alias: HPP1/TENB2/TPEF/TR
• Gene Symbol: TMEFF2
• Recombinant: Yes