Abnova™ Human TNFRSF1A Recombinant Protein

Description

Used for Func, SDS-PAGE

The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease. [provided by RefSeq]

Sequence: MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESSGSFTASENHLRHCLSCSKCRKEMGQVEKSSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN

Specifications

• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 7132
• Molecular Weight (g/mol): 20.9kDa
• Name: TNFRSF1A (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Quality Control Testing: 1 ug/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue
• Quantity: 20 μg
• Immunogen: MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN
• Storage Requirements: Store at -20°C on dry atmosphere. After reconstitution with sterilized water, store at -20°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1 EU/μg
• Gene Alias: CD120a/FPF/MGC19588/TBP1/TNF-R/TNF-R-I/TNF-R55/TNFAR/TNFR1/TNFR55/TNFR60/p55/p55-R/p60
• Common Name: TNFRSF1A
• Gene Symbol: TNFRSF1A
• Biological Activity: The activity is determined by the ability to inhibit the cytolysis 1ng/mL TNFα has on mouse L929 cells in the presence of Actinomycin D. The expected ED50 for this effect is 8-12ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized