Learn More
Abnova™ Human TSLP (Q969D9, 29 a.a. - 159 a.a.) Partial Recombinant Protein
Shop All Abnova Corporation ProductsDescription
This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Alternative splicing of this gene results in two transcript variants. [provided by RefSeq]
Specifications
Specifications
| Accession Number | Q969D9 |
| For Use With (Application) | Functional Study, SDS-PAGE |
| Formulation | Lyophilized |
| Gene ID (Entrez) | 85480 |
| Molecular Weight (g/mol) | 15kDa |
| Name | TSLP (Human) Recombinant Protein |
| Preparation Method | Escherichia coli expression system |
| Purification Method | Ion exchange column and HPLC reverse phase column |
| Quantity | 10 μg |
| Immunogen | YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.