Abnova™ Human TSLP (Q969D9, 29 a.a. - 159 a.a.) Partial Recombinant Protein

Description

Used for Func, SDS-PAGE

This gene encodes a hemopoietic cytokine proposed to signal through a heterodimeric receptor complex composed of the thymic stromal lymphopoietin receptor and the IL-7R alpha chain. It mainly impacts myeloid cells and induces the release of T cell-attracting chemokines from monocytes and enhances the maturation of CD11c(+) dendritic cells. Alternative splicing of this gene results in two transcript variants. [provided by RefSeq]

Sequence: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ

Specifications

• Accession Number: Q969D9
• For Use With (Application): Functional Study, SDS-PAGE
• Formulation: Lyophilized
• Gene ID (Entrez): 85480
• Molecular Weight (g/mol): 15kDa
• Name: TSLP (Human) Recombinant Protein
• Preparation Method: Escherichia coli expression system
• Purification Method: Ion exchange column and HPLC reverse phase column
• Quantity: 10 μg
• Immunogen: YDFTNCDFEKIKAAYLSTISKDLITYMSGTKSTEFNNTVSCSNRPHCLTEIQSLTFNPTAGCASLAKEMFAMKTKAALAIWCPGYSETQINATQAMKKRRKRKVTTNKCLEQVSQLQGLWRRFNRPLLKQQ
• Storage Requirements: Store at -20°C on dry atmosphere for 2 years. After reconstitution with deionized water, store at 4°C for 1 month or store at -20°C for 6 months. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Endotoxin Concentration: <0.1ng/μg (1 EU/μg)
• Common Name: TSLP
• Gene Symbol: TSLP
• Biological Activity: The ED50 was determined by the dose-dependent proliferation of human IL-7R-alpha and human TSLP R co-transfected mouse BaF3 cells, was found to be <3.0ng/mL.
• Species: E. coli
• Recombinant: Recombinant
• Protein Tag: None
• Expression System: Escherichia coli expression system
• Form: Lyophilized
• Purity or Quality Grade: >90% by SDS-PAGE and HPLC