Invitrogen™ Human TTI2 (aa 123-201) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (71%), Rat (71%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54812 (PA5-54812. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

The DNA replication (origin) licensing system is necessary for duplicating the genome in each cell cycle. Geminin is a protein that prevents DNA replication by blocking the MCM complex incorporation into prereplication complex (pre-RC). It is absent during G1 phase and accumulates during S, G2, and M phases of mitosis. It is then degraded during the metaphase-anaphase trasition allowing replication to occur during subsequent cycles. Geminin has also been implicated in maintaining integrity of the male germline genome.

Specifications

• Accession Number: Q6NXR4
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 80185
• Name: Human TTI2 (aa 123-201) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: C8orf41; FLJ23263; MRT39; RGD1310414; Tel2 interacting protein 2 homolog; TELO2 interacting protein 2; TELO2-interacting protein 2; TTI2
• Common Name: TTI2
• Gene Symbol: TTI2
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: LLGKVETAKNSLVGPAWQTGLHHLAGPVYIFAITHSLEQPWTTPRSREVAREVLTSLLQVTECGSVAGFLHGENEDEKG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining