Invitrogen™ Human UBAC1 (aa 298-405) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-52174 (PA5-52174. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

UBAC1 belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein has two RRM domains that bind to RNAs.

Specifications

• Accession Number: Q9BSL1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 10422
• Name: Human UBAC1 (aa 298-405) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 1110033G07Rik; AA407978; E3 ubiquitin-protein ligase subunit KPC2; GBDR1; Gdbr1; glialblastoma cell differentiation-related protein 1; Kip1 ubiquitination-promoting complex protein 2; KPC2; putative glialblastoma cell differentiation-related; putative glialblastoma cell differentiation-related protein; RP11-432J22.3; testicular secretory protein Li 64; UBA domain containing 1; UBA domain-containing protein 1; Ubac1; Ubadc1; ubiquitin associated domain containing 1; ubiquitin-associated domain-containing protein 1
• Common Name: UBAC1
• Gene Symbol: UBAC1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: MEMGFDEKEVIDALRVNNNQQNAACEWLLGDRKPSPEELDKGIDPDSPLFQAILDNPVVQLGLTNPKTLLAFEDMLENPLNSTQWMNDPETGPVMLQISRIFQTLNRT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining