Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Human Ubiquitin/Ubiquitin+1 Antibody, R&D Systems™
GREENER_CHOICE

Catalog No. MAB701SP
Change view
Click to view available options
Quantity:
25 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
MAB701SP 25 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
This item is not returnable. View return policy
Catalog No. MAB701SP Supplier R&D Systems Supplier No. MAB701SP
Add to Cart
Add to Cart
This item is not returnable. View return policy

Mouse Monoclonal Antibody

Ubiquitin/Ubiquitin+1 Monoclonal specifically detects Ubiquitin/Ubiquitin+1 in Human samples. It is validated for Western Blot, Immunohistochemistry.

Specifications

Antigen Ubiquitin/Ubiquitin+1
Applications Western Blot, Immunohistochemistry
Classification Monoclonal
Clone 83406
Concentration LYOPH
Conjugate Unconjugated
Dilution Western Blot 1-2 ug/mL, Immunohistochemistry 8-25 ug/mL
Formulation Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative
Gene Alias HEL-S-50, UBB
Gene Symbols UBB
Host Species Mouse
Immunogen Human Ubiquitin+1 synthetic peptide SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ
Purification Method Protein A or G purified from hybridoma culture supernatant
Quantity 25 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 7314
Test Specificity Detects human Ubiquitin/Ubiquitin+1 in Western blots..
Reconstitution Reconstitute at 0.5 mg/mL in sterile PBS.
Target Species Human
Content And Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution.
Form Purified
Isotype IgG2b
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.