Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Human Ubiquitin/Ubiquitin+1 Antibody, R&D Systems™

Mouse Monoclonal Antibody
Supplier: R&D Systems MAB701
This item is not returnable.
View return policy
Description
Ubiquitin/Ubiquitin+1 Monoclonal specifically detects Ubiquitin/Ubiquitin+1 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
Ubiquitin/Ubiquitin+1 | |
Monoclonal | |
LYOPH | |
Western Blot 1-2 ug/mL, Immunohistochemistry 8-25 ug/mL | |
HEL-S-50, UBB | |
Mouse | |
Protein A or G purified from hybridoma culture supernatant | |
RUO | |
7314 | |
Reconstitute at 0.5 mg/mL in sterile PBS. | |
Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 degreesC as supplied. 1 month, 2 to 8 degreesC under sterile conditions after reconstitution. 6 months, -20 to -70 degreesC under sterile conditions after reconstitution. | |
IgG2b |
Western Blot, Immunohistochemistry | |
83406 | |
Unconjugated | |
Lyophilized from a 0.2 μm filtered solution in PBS with Trehalose. *Small pack size (SP) is supplied as a 0.2 μm filtered solution in PBS. with No Preservative | |
UBB | |
Human Ubiquitin+1 synthetic peptide SSMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEIPPDQQRLIFAGKQ LEDGRTLSDYNIQKESTLHLVLRLRGYADLREDPDRQDHHPGSGAQ | |
100 μg | |
Primary | |
Detects human Ubiquitin/Ubiquitin+1 in Western blots.. | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction