Invitrogen™ Human USP1 (aa 305-378) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (76%), Rat (76%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55852 (PA5-55852. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Deubiquitinating enzymes (DUBs) are capable of producing a free ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins in cells. DUBs possess conserved catalytic regions known as the 'cys domain' and the 'his domain.' There are 2 distinct families of DUBs: ubiquitin-specific processing proteases (UBPs, or USPs) and ubiquitin C-terminal hydrolases (UCHs).

Specifications

• Accession Number: O94782
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7398
• Name: Human USP1 (aa 305-378) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Deubiquitinating enzyme 1; EMBL:AAH92574.1, ECO:0000312; hUBP; MGC137005 protein; RGD:1306461}; ubiquitin carboxyl terminal hydrolase 1; ubiquitin carboxyl-terminal hydrolase 1; ubiquitin carboxyl-terminal hydrolase 1-like protein; ubiquitin specific peptidase 1; ubiquitin specific processing protease 1; ubiquitin specific protease 1; ubiquitin thioesterase 1; ubiquitin thiolesterase 1; ubiquitin-specific-processing protease 1; UBP; usp1; usp1 {ECO:0000312
• Common Name: USP1
• Gene Symbol: USP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: KATSDTLESPPKIIPKYISENESPRPSQKKSRVKINWLKSATKQPSILSKFCSLGKITTNQGVKGQSKENECDP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining