Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Invitrogen™ Human VLK (aa 309-396) Control Fragment Recombinant Protein

Catalog No. RP95070
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (93%), Rat (93%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-82916 (PA5-82916. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

VLK was identified as a novel protein kinase that was induced after the differentiation of cultured embryonic stem cells into mesendoderm. It has no homologs in invertebrates, but is highly conserved in vertebrate species although it does not belong to any known protein kinase groups. VLK is initially expressed in E-cadherin-positive anterior visceral endoderm and mesendoderm, but its expression is later confined to E-cadherin-negative mesenchyme. It is enriched in the Golgi apparatus and is thought to regulate the rate of protein export from the Golgi. Targeted disruption of VLK in mice leads to a defect in lung development and neonatal lethality. It has been suggested that mutations in VLK may be associated with the allergic condition atopy.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q504Y2
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 91461
Name Human VLK (aa 309-396) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias Adtk1; AI115348; AW548124; ESTM17; Extracellular tyrosine-protein kinase PKDCC; MAd1; Pkdcc; protein kinase domain containing, cytoplasmic; protein kinase domain containing, cytoplasmic homolog; protein kinase domain-containing protein, cytoplasmic; Protein kinase-like protein SgK493; RGD1311939; SGK493; Sugen kinase 493; vertebrate lonesome kinase; Vlk; X83346
Common Name VLK
Gene Symbol PKDCC
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence STDCILEFPARNFTLPCSAQGWCEGMNEKRNLYNAYRFFFTYLLPHSAPPSLRPLLDSIVNATGELAWGVDETLAQLEKVLHLYRSGQ
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.