Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Recombinant Proteins
  4. RP94590

Invitrogen™ Human VTA1 (aa 14-79) Control Fragment Recombinant Protein

Catalog No. RP94590
Encompass_Preferred
Click to view available options
Quantity:
100 μL

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (100%), Rat (100%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56605 (PA5-56605. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

C6ORF55 encodes a protein involved in trafficking of the multivesicular body, an endosomal compartment involved in sorting membrane proteins for degradation in lysosomes.
TRUSTED_SUSTAINABILITY

Specifications

Accession Number Q9NP79
Concentration ≥5.0 mg/mL
For Use With (Application) Blocking Assay, Control
Formulation 1 M urea, PBS with no preservative; pH 7.4
Gene ID (Entrez) 51534
Name Human VTA1 (aa 14-79) Control Fragment
Quantity 100 μL
Regulatory Status RUO
Gene Alias 1110001D18Rik; 1110059P08Rik; AU040813; C6orf55; C85340; chromosome 6 open reading frame 55; dopamine-responsive gene 1 protein; DRG1; DRG-1; homolog of mouse SKD1-binding protein 1; HSPC228; LIP5; lysosomal trafficking regulator interacting protein-5; LYST-interacting protein 5; My012; RGD1305031; SBP1; similar to 1110059P08Rik protein; SKD1 binding protein 1; SKD1-binding protein 1; Vacuolar protein sorting-associated protein VTA1 homolog; vesicle (multivesicular body) trafficking 1; vesicle trafficking 1; Vps20-associated 1 homolog; Vps20-associated 1 homolog (S. cerevisiae); Vta1; wu:fb08c11; zgc:64104
Common Name VTA1
Gene Symbol VTA1
Conjugate Unconjugated
Species Human
Recombinant Recombinant
Protein Tag His-ABP-tag
Sequence FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA
Content And Storage -20°C, Avoid Freeze/Thaw Cycles
Expression System E. coli
Form Liquid
Purity or Quality Grade >80% by SDS-PAGE and Coomassie blue staining
Show More Show Less
Product Content Correction

The Fisher Scientific Encompass Program offers items which are not part of our distribution portfolio. These products typically do not have pictures or detailed descriptions. However, we are committed to improving your shopping experience. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.