Invitrogen™ Human WDSOF1 Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (88%), Rat (88%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-60732 (PA5-60732. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Possible role in ribosomal RNA processing. May function as a substrate receptor for CUL4-DDB1 E3 ubiquitin-protein ligase complex.

Specifications

• Accession Number: Q9NV06
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 25879
• Name: Human WDSOF1 Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Dcaf13; DDB1 and CUL4 associated factor 13; DDB1- and CUL4-associated factor 13; Gm83; HSPC064; WD repeat and SOF domain-containing protein 1; WD repeats and SOF domain containing 1; WD repeats and SOF1 domain containing; WDSOF1
• Common Name: WDSOF1
• Gene Symbol: DCAF13
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: GIGTRFCGTSFFTVGDDKTVKQWKMDGPGYGDEEEPLHTILGKTVYTGIDHHWKEAVFATCGQQVDIWDEQRTNPICSMTWGFD
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining