Invitrogen™ Human WHIP Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (97%), Rat (97%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56847 (PA5-56847. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Werner's syndrome is a rare autosomal recessive disorder characterized by accelerated aging that is caused by defects in the Werner syndrome ATP-dependent helicase gene (WRN). The protein encoded by this gene interacts with the exonuclease-containing N-terminal portion of the Werner protein. This protein has a ubiquitin-binding zinc-finger domain in the N-terminus, an ATPase domain, and two leucine zipper motifs in the C-terminus. It has sequence similarity to replication factor C family proteins and is conserved from E. coli to human. This protein likely accumulates at sites of DNA damage by interacting with polyubiquinated proteins and also binds to DNA polymerase delta and increases the initiation frequency of DNA polymerase delta-mediated DNA synthesis. This protein also interacts with nucleoporins at nuclear pore complexes. Two transcript variants encoding different isoforms have been isolated for this gene.

Specifications

• Accession Number: Q96S55
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 56897
• Name: Human WHIP Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4833444L21Rik; ATPase WRNIP1; bA420G6.2; FLJ22526; putative helicase RUVBL; RP11-420G6.2; UniProtKB:Q96S55}; Werner helicasae interacting protein 1; Werner helicase interacting protein 1; Werner helicase-interacting protein 1; Werner syndrome homolog interacting protein; Whip; Wrnip; Wrnip1; wrnip1 {ECO:0000250
• Common Name: WHIP
• Gene Symbol: WRNIP1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: YQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKARLRNHQGPLPPVPLHLRNAPTRLMKDLGYG
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining