Invitrogen™ Human XKR3 (aa 1-30) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (40%), Rat (40%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-57147 (PA5-57147. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

XKRX (MIM 300684) and XKR3 are homologs of the Kell blood group precursor XK (MIM 314850), which is a putative membrane transporter and a component of the XK/Kell complex of the Kell blood group system (Calenda et al., 2006 [PubMed 16431037]).[supplied by OMIM, Mar 2008].

Specifications

• Accession Number: Q5GH77
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 150165
• Name: Human XKR3 (aa 1-30) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: expressed in testis; x Kell blood group precursor-related family, member 3; x Kell blood group-related 3; XK related 3; XK, Kell blood group complex subunit-related family, member 3; XKR3; XK-related protein 3; X-linked Kx blood group related 3; XRG3; XTES
• Common Name: XKR3
• Gene Symbol: XKR3
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: METVFEEMDEESTGGVSSSKEEIVLGQRLH
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining