Invitrogen™ Human XPNPEP1 (aa 314-403) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-110997 (PA5-110997. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

This gene encodes the cytosolic form of a metalloaminopeptidase that catalyzes the cleavage of the N-terminal amino acid adjacent to a proline residue. The gene product may play a role in degradation and maturation of tachykinins, neuropeptides, and peptide hormones. Alternative splicing results in multiple transcript variants.

Specifications

• Accession Number: Q9NQW7
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 7511
• Name: Human XPNPEP1 (aa 314-403) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: Aminoacylproline aminopeptidase; aminopeptidase P, cytosolic; App; APP1; cytoplasmic aminopeptidase P; cytosolic aminopeptidase P; D230045I08Rik; OTTHUMP00000020457; OTTHUMP00000058856; RGD:621274}; sAmp; soluble aminopeptidase P; Xaa-Pro aminopeptidase 1; XPNPEP; XPNPEP1; xpnpep1 {ECO:0000312; XPNPEPL; XPNPEPL1; X-Pro aminopeptidase 1; X-Pro aminopeptidase 1, soluble; X-prolyl aminopeptidase (aminopeptidase P) 1, soluble; X-prolyl aminopeptidase 1; X-prolyl aminopeptidase 1, soluble
• Common Name: XPNPEP1
• Gene Symbol: Xpnpep1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: PICIAKAVKNSAESEGMRRAHIKDAVALCELFNWLEKEVPKGGVTEISAADKAEEFRRQQADFVDLSFPTISSTGPNGAIIHYAPVPETN
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining