Invitrogen™ Human ZBTB49 (aa 45-153) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (82%), Rat (82%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-55081 (PA5-55081. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Transcription factor. Inhibits cell proliferation by activating either CDKN1A/p21 transcription or RB1 transcription. [UniProt]

Specifications

• Accession Number: Q6ZSB9
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 166793
• Name: Human ZBTB49 (aa 45-153) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 4930518A03Rik; Zbtb49; Zfp509; zinc finger and BTB domain containing 49; zinc finger and BTB domain-containing protein 49; Zinc finger protein 509; ZNF509
• Common Name: ZBTB49
• Gene Symbol: ZBTB49
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: AFSQYFRSLFQNSSSQKNDVFHLDVKNVSGIGQILDFMYTSHLDLNQDNIQVMLDTAQCLQVQNVLSLCHTFLKSATVVQPPGMPCNSTLSLQSTLTPDATCVISENYP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining