Invitrogen™ Human ZFAND1 (aa 8-80) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (78%), Rat (78%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-54782 (PA5-54782. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. The majority of zinc-finger proteins contain a Kruppel-type DNA binding domain and a KRAB domain, which is thought to interact with KAP1, thereby recruiting histone modifying proteins. ZFAND1 (AN1-type zinc finger protein 1) is a 268 amino acid protein that contains 2 AN1-type zinc fingers, which are often found in proteins that contain a ubiquitin-like domain and therefore play a role in the ubiquitination pathway. AN1-type zinc fingers contains six conserved cysteines and two histidines and have a dimetal (zinc)-bound alpha/beta fold. There are two isoforms of ZFAND1 that are produced as a result of alternative splicing events.

Specifications

• Accession Number: Q8TCF1
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 79752
• Name: Human ZFAND1 (aa 8-80) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: AN1-type zinc finger protein 1; FLJ14007; ZFAN1; ZFAND1; zinc finger AN1-type containing 1; Zinc finger AN1-type-containing protein 1; zinc finger, AN1-type domain 1
• Common Name: ZFAND1
• Gene Symbol: ZFAND1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: QHCQVEHCRQRDFLPFVCDDCSGIFCLEHRSRESHGCPEVTVINERLKTDQHTSYPCSFKDCAERELVAVICP
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining