Abnova™ Human ZNRF1 Full-length ORF (NP_115644.1, 1 a.a. - 227 a.a.) Recombinant Protein with GST-tag at N-terminal

Description

Used for AP, Array, ELISA, WB-Re

In a study identifying genes in rat that are upregulated in response to nerve damage, a gene which is highly expressed in ganglia and in the central nervous system was found. The protein encoded by the rat gene contains both a zinc finger and a RING finger motif and is localized in the endosome/lysosome compartment, indicating that it may be involved in ubiquitin-mediated protein modification. The protein encoded by this human gene is highly similar in sequence to that encoded by the rat gene. [provided by RefSeq]

Sequence: MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD

Specifications

• Accession Number: NP_115644.1
• For Use With (Application): Antibody Production, Protein Array, ELISA, Western Blot
• Formulation: 50mM Tris-HCI, 10mM reduced Glutathione, pH=8.0 in the elution buffer.
• Gene ID (Entrez): 84937
• Molecular Weight (g/mol): 50.2kDa
• Name: ZNRF1 (Human) Recombinant Protein (P01)
• Purification Method: Glutathione Sepharose 4 Fast Flow
• Quality Control Testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
• Quantity: 25 μg
• Immunogen: MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMDPSTAGGVPFGLYTPASRGTGDSERAPGGGGSASDSTYAHGNGYQETGGGHHRDGMLYLGSRASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKDAGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD
• Storage Requirements: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Regulatory Status: RUO
• Gene Alias: DKFZp434E229/FLJ14846/MGC15430/NIN283
• Common Name: ZNRF1
• Gene Symbol: ZNRF1
• Species: Wheat Germ (in vitro)
• Recombinant: Recombinant
• Protein Tag: GST
• Expression System: wheat germ expression system
• Form: Liquid