Invitrogen™ Human ZRANB1 (aa 208-296) Control Fragment Recombinant Protein

Description

Recombinant Protein

Highest antigen sequence indentity to the following orthologs: Mouse (98%), Rat (98%). This recombinant protein control fragment may be used for blocking experiments with the corresponding antibody, PA5-56088 (PA5-56088. In IHC/ICC and WB experiments, we recommend a 100x molar excess of the protein fragment control based on the concentration and the molecular weight. Pre-incubate the antibody-protein control fragment mixture for 30 min at room temperature.

ZRANB1 is a positive regulator of the Wnt signaling pathway that specifically cleaves 'Lys-63'-linked ubiquitin chains. It acts by deubiquitinating APC protein, a negative regulator of Wnt-mediated transcription and may also modulate TNF-alpha signaling.

Specifications

• Accession Number: Q9UGI0
• Concentration: ≥5.0 mg/mL
• For Use With (Application): Blocking Assay, Control
• Formulation: 1 M urea, PBS with no preservative; pH 7.4
• Gene ID (Entrez): 54764
• Name: Human ZRANB1 (aa 208-296) Control Fragment
• Quantity: 100 μL
• Regulatory Status: RUO
• Gene Alias: 9330160G10Rik; D7Wsu87e; DKFZp762P2216; Gm1956; hTrabid; Trabid; TRAF-binding domain-containing protein; TRAF-binding protein; TRAF-binding protein domain; ubiquitin thioesterase ZRANB1; Zinc finger Ran-binding domain-containing protein 1; zinc finger RANBP2-type containing 1; zinc finger, RAN-binding domain containing 1; ZRANB1
• Common Name: ZRANB1
• Gene Symbol: ZRANB1
• Conjugate: Unconjugated
• Species: Human
• Recombinant: Recombinant
• Protein Tag: His-ABP-tag
• Sequence: SSGNSQRRSPPATKRDSEVKMDFQRIELAGAVGSKEELEVDFKKLKQIKNRMKKTDWLFLNACVGVVEGDLAAIEAYKSSGGDIARQLT
• Content And Storage: -20°C, Avoid Freeze/Thaw Cycles
• Expression System: E. coli
• Form: Liquid
• Purity or Quality Grade: >80% by SDS-PAGE and Coomassie blue staining