Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Hyaluronan Synthase 3/HAS3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$382.00 - $646.00
Specifications
Antigen | Hyaluronan Synthase 3/HAS3 |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
Hyaluronan Synthase 3/HAS3 Polyclonal specifically detects Hyaluronan Synthase 3/HAS3 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
Hyaluronan Synthase 3/HAS3 | |
Unconjugated | |
RUO | |
EC 2.4.1.212, HA synthase 3, hyaluronan synthase 3, Hyaluronate synthase 3, Hyaluronic acid synthase 3 | |
HAS3 | |
IgG | |
Affinity Purified | |
Specificity of human Hyaluronan Synthase 3/HAS3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Polyclonal | |
Rabbit | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
3038 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:RQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSC | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title