Hyaluronan Synthase 3/HAS3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP162551

Catalog No. NBP162551

Description

Hyaluronan Synthase 3/HAS3 Polyclonal specifically detects Hyaluronan Synthase 3/HAS3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Hyaluronan Synthase 3/HAS3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: EC 2.4.1.212, HA synthase 3, hyaluronan synthase 3, Hyaluronate synthase 3, Hyaluronic acid synthase 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 63 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O00219
• Gene Symbols: HAS3
• Immunogen: Synthetic peptide directed towards the N terminal of human HAS3 (NP_005320). Peptide sequence GQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3038
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG

For Research Use Only