Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Hydroxyacid Oxidase-1/HAO-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Hydroxyacid Oxidase-1/HAO-1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Hydroxyacid Oxidase-1/HAO-1 Polyclonal specifically detects Hydroxyacid Oxidase-1/HAO-1 in Human samples. It is validated for Western Blot.Specifications
Hydroxyacid Oxidase-1/HAO-1 | |
Polyclonal | |
Rabbit | |
Q9UJM8 | |
54363 | |
Synthetic peptides corresponding to HAO1(hydroxyacid oxidase (glycolate oxidase) 1) The peptide sequence was selected from the C terminal of HAO1. Peptide sequence GLNGILVSNHGARQLDGVPATIDVLPEIVEAVEGKVEVFLDGGVRKGTDV. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
(S)-2-hydroxy-acid oxidase, EC 1.1.3.15, Glycolate oxidase, GOX1MGC142227, GOXMGC142225, HAOX1, hydroxyacid oxidase (glycolate oxidase) 1, hydroxyacid oxidase 1 | |
HAO1 | |
IgG | |
41 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title