Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
hydroxysteroid (17-beta) dehydrogenase 11 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
$405.00 - $670.00
Specifications
Antigen | hydroxysteroid (17-beta) dehydrogenase 11 |
---|---|
Dilution | Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 |
Applications | Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
hydroxysteroid (17-beta) dehydrogenase 11 Polyclonal specifically detects hydroxysteroid (17-beta) dehydrogenase 11 in Human samples. It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
hydroxysteroid (17-beta) dehydrogenase 11 | |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
Human | |
17betaHSD11, 17betaHSDXI, 17-beta-hydroxysteroid dehydrogenase 11, 17-beta-hydroxysteroid dehydrogenase type XI, 17-beta-hydroxysteroid dehydrogenase XI, 17bHSD11, CTCL-associated antigen HD-CL-03, dehydrogenase/reductase (SDR family) member 8, DHRS8, EC 1.1.1, EC 1.1.1.62, hydroxysteroid (17-beta) dehydrogenase 11, member 2,17-beta-HSD 11, PAN1BRETSDR2,17-BETA-HSD11, retSDR2, RetSDR2,17-BETA-HSDXI, SDR16C2,17BHSD11, T-cell lymphoma-associated antigen HD-CL-03,17-beta-HSD XI | |
HSD17B11 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Polyclonal | |
Rabbit | |
Lipid and Metabolism | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
51170 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:FVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGY | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title