HYPE Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP258855

Catalog No. NBP258855

Description

HYPE Polyclonal specifically detects HYPE in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: HYPE
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: AMPylator FICD, EC 2.7.7.n1, FIC domain containing, FIC domain-containing protein, fic S-phase protein cell division homolog, HIP-13, HIP13UNQ3041, huntingtin interacting protein 13, Huntingtin interacting protein E, huntingtin interactor protein E, Huntingtin yeast partner E, Huntingtin-interacting protein 13, Huntingtin-interacting protein E, HYPEadenosine monophosphate-protein transferase FICD, MGC5623
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: FICD
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VKKVMSIPKGNSALRRVMEETYYHHIYHTVAIEGNTLTLSEIRHILETRYAVPGKSLEEQNEVIGMHAAMKYINTTLVSRIGSVTISD
• Quantity: 100 μL
• Research Discipline: Cell Cycle and Replication
• Gene ID (Entrez): 11153
• Target Species: Human
• Isotype: IgG

For Research Use Only