Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IA-2/PTPRN Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
| Antigen | IA-2/PTPRN |
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
IA-2/PTPRN Polyclonal specifically detects IA-2/PTPRN in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| IA-2/PTPRN | |
| Polyclonal | |
| Rabbit | |
| Immune System Diseases, Immunology, Lipid and Metabolism | |
| CA 512, EC 3.1.3.48, FLJ16131, IA2, IA-2, IA-2/PTP, ICA 512, ICA3, ICA512, islet cell antigen 2, Islet cell antigen 512, Islet cell autoantigen 3, protein tyrosine phosphatase, receptor type, N, protein tyrosine phosphatase-like N, PTP IA-2, receptor-type tyrosine-protein phosphatase-like N, R-PTP-N | |
| PTPRN | |
| IgG | |
| Affinity Purified |
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Human | |
| 5798 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEGYEKEGLGDRGEKPASPAVQPDAALQRLAAVLAGYGVELRQLTPEQLSTLLTLLQLLPKGA | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title