Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

IBRDC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$152.22 - $436.00

Specifications

Antigen IBRDC1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP15977620
View Documents
Novus Biologicals
NBP15977620UL
20 μL
Each for $152.22
Add to cart
 
NBP159776
View Documents
Novus Biologicals
NBP159776
100 μL
Each for $436.00
Add to cart
 
Description

Description

IBRDC1 Polyclonal specifically detects IBRDC1 in Human samples. It is validated for Western Blot.
Specifications

Specifications

IBRDC1
Polyclonal
Rabbit
Q8TC41
154214
Synthetic peptides corresponding to RNF217(ring finger protein 217) The peptide sequence was selected from the middle region of RNF217. Peptide sequence GLALGAIAVVIVEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
Western Blot
Unconjugated
RUO
C6orf172, chromosome 6 open reading frame 172, dJ84N20.1, EC 6.3.2.-, IBR domain containing 1, IBRDC1, MGC26996, probable E3 ubiquitin-protein ligase RNF217, ring finger protein 217IBR domain-containing protein 1
RNF217
IgG
Affinity Purified
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit