Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IBRDC1 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$152.22 - $436.00
Specifications
Antigen | IBRDC1 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP15977620
|
Novus Biologicals
NBP15977620UL |
20 μL |
Each for $152.22
|
|
NBP159776
|
Novus Biologicals
NBP159776 |
100 μL |
Each for $436.00
|
|
Description
IBRDC1 Polyclonal specifically detects IBRDC1 in Human samples. It is validated for Western Blot.Specifications
IBRDC1 | |
Polyclonal | |
Rabbit | |
Q8TC41 | |
154214 | |
Synthetic peptides corresponding to RNF217(ring finger protein 217) The peptide sequence was selected from the middle region of RNF217. Peptide sequence GLALGAIAVVIVEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQV. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
RUO | |
C6orf172, chromosome 6 open reading frame 172, dJ84N20.1, EC 6.3.2.-, IBR domain containing 1, IBRDC1, MGC26996, probable E3 ubiquitin-protein ligase RNF217, ring finger protein 217IBR domain-containing protein 1 | |
RNF217 | |
IgG | |
Affinity Purified |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title