Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
IBRDC1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | IBRDC1 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP15977620
|
Novus Biologicals
NBP15977620UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP159776
|
Novus Biologicals
NBP159776 |
100 μL |
Each for $487.50
|
|
|||||
Description
IBRDC1 Polyclonal specifically detects IBRDC1 in Human samples. It is validated for Western Blot.Specifications
| IBRDC1 | |
| Polyclonal | |
| Rabbit | |
| Q8TC41 | |
| 154214 | |
| Synthetic peptides corresponding to RNF217(ring finger protein 217) The peptide sequence was selected from the middle region of RNF217. Peptide sequence GLALGAIAVVIVEEIKTYWNLISGRTRNQTQHLAPQPVLLSDMLYCLKQV. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| C6orf172, chromosome 6 open reading frame 172, dJ84N20.1, EC 6.3.2.-, IBR domain containing 1, IBRDC1, MGC26996, probable E3 ubiquitin-protein ligase RNF217, ring finger protein 217IBR domain-containing protein 1 | |
| RNF217 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title