Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ICAP-1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00
Specifications
Antigen | ICAP-1 |
---|---|
Dilution | Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ICAP-1 Polyclonal antibody specifically detects ICAP-1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
ICAP-1 | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Cancer, Cell Biology, Cellular Markers, Cytokine Research, Immunology, Mesenchymal Stem Cell Markers, Neuronal Cell Markers, Signal Transduction, Stem Cell Markers | |
PBS (pH 7.2) and 40% Glycerol | |
9270 | |
IgG | |
Protein A purified |
Immunocytochemistry/ Immunofluorescence 0.25-2 μg/mL | |
Polyclonal | |
Purified | |
RUO | |
Human | |
bodenin, DKFZp686K08158, ICAP-1, ICAP-1alpha, ICAP-1B, ICAP1ICAP1AICAP1BICAP-1A, integrin beta 1 binding protein 1, integrin beta-1-binding protein 1, Integrin cytoplasmic domain-associated protein 1, integrin cytoplasmic domain-associated protein 1-alpha, integrin cytoplasmic domain-associated protein 1-beta | |
This antibody was developed against a recombinant protein corresponding to amino acids: VSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGAGKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLT | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title